PDB entry 1ble

View 1ble on RCSB PDB site
Description: phosphoenolpyruvate-dependent phosphotransferase system
Class: phosphotransferase
Keywords: phosphotransferase, sugar transport
Deposited on 1997-05-15, released 1997-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.185
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose permease
    Species: Bacillus subtilis [TaxId:1423]
    Gene: LEVE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1blea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bleA (A:)
    mmnivlariddrfihgqiltrwikvhaadriivvsddiaqdemrktlilsvapsnvkasa
    vsvskmakafhspryegvtamllfenpsdivslieagvpiktvnvggmrfenhrrqitks
    vsvteqdikafetlsdkgvklelrqlpsdasedfvqilrnvtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bleA (A:)
    mnivlariddrfihgqiltrwikvhaadriivvsddiaqdemrktlilsvapsnvkasav
    svskmakafhspryegvtamllfenpsdivslieagvpiktvnvggmrfenhrrqitksv
    svteqdikafetlsdkgvklelrqlpsdasedfvqilrnvt