![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (71 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [324612] (22 PDB entries) |
![]() | Domain d5ecrb2: 5ecr B:84-217 [324726] Other proteins in same PDB: d5ecrb1, d5ecrc1, d5ecre1, d5ecrf1 automated match to d2vo4a2 complexed with gsh, jaa, mg, val |
PDB Entry: 5ecr (more details), 1.72 Å
SCOPe Domain Sequences for d5ecrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ecrb2 a.45.1.0 (B:84-217) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ffpsdpygraqarfwadfvdkkftdaqfkvwgkkgeeqeagkkefieavkileselgdkp yfggdsfgyvdislitfsswfqayekfgnfsiesespkliawakrcmekesvskslpdse kivayaaeyrknnl
Timeline for d5ecrb2: