Class a: All alpha proteins [46456] (289 folds) |
Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily) core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets duplication: consists of two structural repeats |
Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) binds to the transactivation domain of human p53 |
Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins) Pfam PF02201 |
Protein MDM2 [47594] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47596] (76 PDB entries) |
Domain d5layf_: 5lay F: [324712] automated match to d4ereb_ complexed with 6ss, gol, so4 |
PDB Entry: 5lay (more details), 2.71 Å
SCOPe Domain Sequences for d5layf_:
Sequence, based on SEQRES records: (download)
>d5layf_ a.42.1.1 (F:) MDM2 {Human (Homo sapiens) [TaxId: 9606]} eqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndll gdlfgvpsfsvkehrkiytmiyr
>d5layf_ a.42.1.1 (F:) MDM2 {Human (Homo sapiens) [TaxId: 9606]} eqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndll gdlfgvpsfsehrkiytmiyr
Timeline for d5layf_: