SCOPe 2.07: Domain d5layf_: 5lay F:

Lineage for d5layf_ (5lay F:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
   Pfam PF02201

6. Protein MDM2 [47594] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47596] (76 PDB entries)

8. Domain d5layf_: 5lay F: [324712]
   automated match to d4ereb_
   complexed with 6ss, gol, so4

Details for d5layf_

PDB Entry: 5lay, 2.71 Å

PDB Description: discovery of new natural-product-inspired spiro-oxindole compounds as orally active inhibitors of the mdm2-p53 interaction: hdm2 (mdm2) in complex with compound 6g

PDB Compounds: (F:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d5layf_:

Sequence, based on SEQRES records:

>d5layf_ a.42.1.1 (F:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
eqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndll
gdlfgvpsfsvkehrkiytmiyr

Sequence, based on observed residues (ATOM records):

>d5layf_ a.42.1.1 (F:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
eqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndll
gdlfgvpsfsehrkiytmiyr

Timeline for d5layf_:

• d5layf_ first appeared in SCOPe 2.06
  
• d5layf_ appears in the current release, SCOPe 2.08