Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Enterococcus hirae [TaxId:768486] [324660] (2 PDB entries) |
Domain d5kncd2: 5knc D:76-351 [324666] Other proteins in same PDB: d5kncd1, d5kncd3, d5knce1, d5knce3, d5kncf1, d5kncf3, d5kncg_ automated match to d3vr4d2 complexed with adp, gol, mg, so4 |
PDB Entry: 5knc (more details), 3.02 Å
SCOPe Domain Sequences for d5kncd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kncd2 c.37.1.0 (D:76-351) automated matches {Enterococcus hirae [TaxId: 768486]} plqlgvsedmigrvfdglgrpkdngpeilpekyldingevinpiardypdefiqtgisai dhlntlvrgqklpvfsgsglphkelaaqiarqatvldssddfavvfaaigitfeeaeffm edfrqtgaidrsvmfmnlandpaieriatprmaltaaeylayekgmhvlvimtdmtnyae alreisaarrevpgrrgypgylytnlatlferagrirglkgsvtqipiltmpeddkthpi pdltgyitegqiiltrelyksgiqppidvlpslsrl
Timeline for d5kncd2: