![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein automated matches [190241] (13 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [324445] (3 PDB entries) |
![]() | Domain d5j9ue_: 5j9u E: [324519] automated match to d3to7a_ |
PDB Entry: 5j9u (more details), 2.95 Å
SCOPe Domain Sequences for d5j9ue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j9ue_ d.108.1.1 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} smtqnphevarvrnlnriimgkyeiepwyfspypieltdedfiyiddftlqyfgskkqye ryrkkctlrhppgneiyrddyvsffeidgrkqrtwcrnlcllsklfldhktlyydvdpfl fycmtrrdelghhlvgyfskekesadgynvaciltlpqyqrmgygklliefsyelskken kvgspekplsdlgllsyraywsdtlitllvehqkeitideissmtsmtttdilhtaktln ilryykgqhiiflnedildrynrlkakkrrtidpnrliwkppvftasqlrfaw
Timeline for d5j9ue_: