Lineage for d5j9ue_ (5j9u E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2574995Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2575349Protein automated matches [190241] (13 species)
    not a true protein
  7. 2575364Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [324445] (3 PDB entries)
  8. 2575372Domain d5j9ue_: 5j9u E: [324519]
    automated match to d3to7a_

Details for d5j9ue_

PDB Entry: 5j9u (more details), 2.95 Å

PDB Description: crystal structure of the nua4 core complex
PDB Compounds: (E:) Histone acetyltransferase ESA1

SCOPe Domain Sequences for d5j9ue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j9ue_ d.108.1.1 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
smtqnphevarvrnlnriimgkyeiepwyfspypieltdedfiyiddftlqyfgskkqye
ryrkkctlrhppgneiyrddyvsffeidgrkqrtwcrnlcllsklfldhktlyydvdpfl
fycmtrrdelghhlvgyfskekesadgynvaciltlpqyqrmgygklliefsyelskken
kvgspekplsdlgllsyraywsdtlitllvehqkeitideissmtsmtttdilhtaktln
ilryykgqhiiflnedildrynrlkakkrrtidpnrliwkppvftasqlrfaw

SCOPe Domain Coordinates for d5j9ue_:

Click to download the PDB-style file with coordinates for d5j9ue_.
(The format of our PDB-style files is described here.)

Timeline for d5j9ue_: