Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) contains similar fold but lacks its catalytic centre |
Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins) family GH20 |
Protein beta-N-acetylhexosaminidase, N-terminal domain [64343] (1 species) |
Species Streptomyces plicatus [TaxId:1922] [64344] (8 PDB entries) |
Domain d5fcza1: 5fcz A:8-150 [324416] Other proteins in same PDB: d5fcza2 automated match to d1jaka2 complexed with cl, gol, so4, tnx |
PDB Entry: 5fcz (more details), 2.45 Å
SCOPe Domain Sequences for d5fcza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fcza1 d.92.2.1 (A:8-150) beta-N-acetylhexosaminidase, N-terminal domain {Streptomyces plicatus [TaxId: 1922]} drkapvrptpldrvipapasvdpggapyritrgthirvddsrearrvgdyladllrpatg yrlpvtahghggirlrlaggpygdegyrldsgpagvtitarkaaglfhgvqtlrqllppa vekdsaqpgpwlvaggtiedtpr
Timeline for d5fcza1: