Lineage for d5azja2 (5azj A:263-511)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2493486Species Trypanosoma brucei [TaxId:31285] [268052] (13 PDB entries)
  8. 2493540Domain d5azja2: 5azj A:263-511 [324334]
    Other proteins in same PDB: d5azja3, d5azjb3, d5azjc3, d5azjd3
    automated match to d3wxla2
    complexed with 4np, gol

Details for d5azja2

PDB Entry: 5azj (more details), 2.61 Å

PDB Description: crystal structure of glycerol kinase from trypanosoma brucei gambiense complexed with 4np (with disulfide bridge)
PDB Compounds: (A:) glycerol kinase

SCOPe Domain Sequences for d5azja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5azja2 c.55.1.0 (A:263-511) automated matches {Trypanosoma brucei [TaxId: 31285]}
mcfekgeakntygtgcfllmnvgeearfskhgllstvgfqvgrdgpcyyalegaiacaga
tvewmrrnmnlfshiteceklarsvpgtqgivfvpafsgllapywdpsargtivgmtlkt
trahviraalqaialqlndvvgsmkrdaglnlsslrvdgglskngllmeiqasllgvdil
vpsmhettalgaalcaglaagvwtsleevkavsrrenswktvspsgsamereamiaewre
alkrtkwak

SCOPe Domain Coordinates for d5azja2:

Click to download the PDB-style file with coordinates for d5azja2.
(The format of our PDB-style files is described here.)

Timeline for d5azja2: