Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (35 species) not a true protein |
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [195048] (6 PDB entries) |
Domain d4yzna_: 4yzn A: [324314] automated match to d4qqja_ complexed with 4k5 |
PDB Entry: 4yzn (more details), 1.55 Å
SCOPe Domain Sequences for d4yzna_:
Sequence, based on SEQRES records: (download)
>d4yzna_ d.144.1.0 (A:) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} ptladneieyekqigkggfglvhkgrlvkdksvvaikslilgdsegetemiekfqefqre vfimsnlnhpnivklyglmhnpprmvmelvpcgdlyhrlldkahpikwsvklrlmldial gieymqnqnppivhrdlrspnillqsldenapvcakvadfglsqqsvhsvsgllgnfqwm apetigaeeesytekadtysfamilytiltgegpfdeysygkikfinmireeglrptipe dcpprlrnvielcwsgdpkkrphfsyivkelsel
>d4yzna_ d.144.1.0 (A:) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} ptladneieyekqigkggfglvhkgrlvkdksvvaiksliletemiekfqefqrevfims nlnhpnivklyglmhnpprmvmelvpcgdlyhrlldkahpikwsvklrlmldialgieym qnqnppivhrdlrspnillqsldenapvcakvadfglsqqsvhsvsgllgnfqwmapeti gaeeesytekadtysfamilytiltgegpfdeysygkikfinmireeglrptipedcppr lrnvielcwsgdpkkrphfsyivkelsel
Timeline for d4yzna_: