Lineage for d1d2na_ (1d2n A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479032Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2479154Protein Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein [52717] (1 species)
  7. 2479155Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [52718] (2 PDB entries)
  8. 2479156Domain d1d2na_: 1d2n A: [32428]
    complexed with anp, gol, mg

Details for d1d2na_

PDB Entry: 1d2n (more details), 1.75 Å

PDB Description: d2 domain of n-ethylmaleimide-sensitive fusion protein
PDB Compounds: (A:) n-ethylmaleimide-sensitive fusion protein

SCOPe Domain Sequences for d1d2na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
edyasyimngiikwgdpvtrvlddgellvqqtknsdrtplvsvllegpphsgktalaaki
aeesnfpfikicspdkmigfsetakcqamkkifddayksqlscvvvddierlldyvpigp
rfsnlvlqallvllkkappqgrklliigttsrkdvlqememlnafsttihvpniatgeql
lealellgnfkdkerttiaqqvkgkkvwigikkllmliemslqmdpeyrvrkflallree
gaspld

SCOPe Domain Coordinates for d1d2na_:

Click to download the PDB-style file with coordinates for d1d2na_.
(The format of our PDB-style files is described here.)

Timeline for d1d2na_: