Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (15 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein [52717] (1 species) |
Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [52718] (2 PDB entries) |
Domain d1d2na_: 1d2n A: [32428] complexed with anp, gol, mg |
PDB Entry: 1d2n (more details), 1.75 Å
SCOP Domain Sequences for d1d2na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus)} edyasyimngiikwgdpvtrvlddgellvqqtknsdrtplvsvllegpphsgktalaaki aeesnfpfikicspdkmigfsetakcqamkkifddayksqlscvvvddierlldyvpigp rfsnlvlqallvllkkappqgrklliigttsrkdvlqememlnafsttihvpniatgeql lealellgnfkdkerttiaqqvkgkkvwigikkllmliemslqmdpeyrvrkflallree gaspld
Timeline for d1d2na_: