Lineage for d1d2na_ (1d2n A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 394970Family c.37.1.20: Extended AAA-ATPase domain [81269] (18 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 395030Protein Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein [52717] (1 species)
  7. 395031Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [52718] (2 PDB entries)
  8. 395032Domain d1d2na_: 1d2n A: [32428]
    complexed with anp, gol, mg

Details for d1d2na_

PDB Entry: 1d2n (more details), 1.75 Å

PDB Description: d2 domain of n-ethylmaleimide-sensitive fusion protein

SCOP Domain Sequences for d1d2na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus)}
edyasyimngiikwgdpvtrvlddgellvqqtknsdrtplvsvllegpphsgktalaaki
aeesnfpfikicspdkmigfsetakcqamkkifddayksqlscvvvddierlldyvpigp
rfsnlvlqallvllkkappqgrklliigttsrkdvlqememlnafsttihvpniatgeql
lealellgnfkdkerttiaqqvkgkkvwigikkllmliemslqmdpeyrvrkflallree
gaspld

SCOP Domain Coordinates for d1d2na_:

Click to download the PDB-style file with coordinates for d1d2na_.
(The format of our PDB-style files is described here.)

Timeline for d1d2na_: