Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.7: 14-3-3 protein [48445] (1 family) automatically mapped to Pfam PF00244 |
Family a.118.7.1: 14-3-3 protein [48446] (5 proteins) |
Protein automated matches [190238] (10 species) not a true protein |
Species Lachancea thermotolerans [TaxId:559295] [324264] (1 PDB entry) |
Domain d5lvza_: 5lvz A: [324265] automated match to d4dnkb_ |
PDB Entry: 5lvz (more details), 1.95 Å
SCOPe Domain Sequences for d5lvza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lvza_ a.118.7.1 (A:) automated matches {Lachancea thermotolerans [TaxId: 559295]} sredsvylaklaeqaeryeemvdsmkavassgqelsveernllsvayknvigarraswri vssieqkeeakdksehqvklirdyrskieteltkicddilsvldthlipsattgeskvfy ykmkgdyhrylaefssgevrdkatnasleayktaseiattelppthpirlglalnfsvfy yeiqnspdkachlakqafddaiaeldtlseesykdstlimqllrdnltlwtsdms
Timeline for d5lvza_: