Lineage for d5lvza_ (5lvz A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2339527Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2339528Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2339586Protein automated matches [190238] (10 species)
    not a true protein
  7. 2339695Species Lachancea thermotolerans [TaxId:559295] [324264] (1 PDB entry)
  8. 2339696Domain d5lvza_: 5lvz A: [324265]
    automated match to d4dnkb_

Details for d5lvza_

PDB Entry: 5lvz (more details), 1.95 Å

PDB Description: crystal structure of yeast 14-3-3 protein from lachancea thermotolerans
PDB Compounds: (A:) KLTH0G14146p

SCOPe Domain Sequences for d5lvza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lvza_ a.118.7.1 (A:) automated matches {Lachancea thermotolerans [TaxId: 559295]}
sredsvylaklaeqaeryeemvdsmkavassgqelsveernllsvayknvigarraswri
vssieqkeeakdksehqvklirdyrskieteltkicddilsvldthlipsattgeskvfy
ykmkgdyhrylaefssgevrdkatnasleayktaseiattelppthpirlglalnfsvfy
yeiqnspdkachlakqafddaiaeldtlseesykdstlimqllrdnltlwtsdms

SCOPe Domain Coordinates for d5lvza_:

Click to download the PDB-style file with coordinates for d5lvza_.
(The format of our PDB-style files is described here.)

Timeline for d5lvza_: