Lineage for d5b7fa1 (5b7f A:31-170)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381028Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2381153Protein multi-copper oxidase CueO [69194] (1 species)
  7. 2381154Species Escherichia coli [TaxId:562] [69195] (38 PDB entries)
  8. 2381209Domain d5b7fa1: 5b7f A:31-170 [324162]
    automated match to d1kv7a1
    complexed with ca, cu, edo

Details for d5b7fa1

PDB Entry: 5b7f (more details), 1.45 Å

PDB Description: structure of cueo - the signal peptide was truncated by hrv3c protease
PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d5b7fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b7fa1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
rptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtvdi
ynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgktgr
qvamglaglvvieddeilkl

SCOPe Domain Coordinates for d5b7fa1:

Click to download the PDB-style file with coordinates for d5b7fa1.
(The format of our PDB-style files is described here.)

Timeline for d5b7fa1: