Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
Protein Initiation factor 4a [52706] (2 species) homologous to UvrB |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52707] (4 PDB entries) |
Domain d1fuub2: 1fuu B:226-394 [32414] |
PDB Entry: 1fuu (more details), 2.5 Å
SCOPe Domain Sequences for d1fuub2:
Sequence, based on SEQRES records: (download)
>d1fuub2 c.37.1.19 (B:226-394) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} deltlegikqfyvnveeeeykyecltdlydsisvtqavifcntrrkveelttklrndkft vsaiysdlpqqerdtimkefrsgssrilistdllargidvqqvslvinydlpankenyih rigrggrfgrkgvainfvtnedvgamrelekfystqieelpsdiatlln
>d1fuub2 c.37.1.19 (B:226-394) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} deltlegikqfyvnveeeeykyecltdlydsisvtqavifcntrrkveelttklrndkft vsaiysdlpqqerdtimkefrsgssrilistdllargidvqqvslvinydlpankenyih rigrggkgvainfvtnedvgamrelekfystqieelpsdiatlln
Timeline for d1fuub2: