Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein automated matches [227019] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [232826] (7 PDB entries) |
Domain d4yqua1: 4yqu A:4-102 [324035] Other proteins in same PDB: d4yqua2, d4yqub2 automated match to d1eema2 complexed with 4gb, mes |
PDB Entry: 4yqu (more details), 1.94 Å
SCOPe Domain Sequences for d4yqua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yqua1 c.47.1.5 (A:4-102) automated matches {Human (Homo sapiens) [TaxId: 9606]} esarslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkpewf fkknpfglvpvlensqgqliyesaitceyldeaypgkkl
Timeline for d4yqua1: