Lineage for d4yqua1 (4yqu A:4-102)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132062Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2132690Protein automated matches [227019] (3 species)
    not a true protein
  7. 2132734Species Human (Homo sapiens) [TaxId:9606] [232826] (7 PDB entries)
  8. 2132744Domain d4yqua1: 4yqu A:4-102 [324035]
    Other proteins in same PDB: d4yqua2, d4yqub2
    automated match to d1eema2
    complexed with 4gb, mes

Details for d4yqua1

PDB Entry: 4yqu (more details), 1.94 Å

PDB Description: glutathione s-transferase omega 1 bound to covalent inhibitor c1-31
PDB Compounds: (A:) Glutathione S-transferase omega-1

SCOPe Domain Sequences for d4yqua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yqua1 c.47.1.5 (A:4-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esarslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkpewf
fkknpfglvpvlensqgqliyesaitceyldeaypgkkl

SCOPe Domain Coordinates for d4yqua1:

Click to download the PDB-style file with coordinates for d4yqua1.
(The format of our PDB-style files is described here.)

Timeline for d4yqua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4yqua2