Lineage for d1uaaa1 (1uaa A:2-307)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1165966Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 1165975Protein DEXX box DNA helicase [52701] (2 species)
    each AAA domain contains an all-alpha insert subdomain
  7. 1165988Species Escherichia coli, RepD [TaxId:562] [52703] (1 PDB entry)
  8. 1165989Domain d1uaaa1: 1uaa A:2-307 [32401]
    protein/DNA complex

Details for d1uaaa1

PDB Entry: 1uaa (more details), 3 Å

PDB Description: e. coli rep helicase/dna complex
PDB Compounds: (A:) protein (ATP-dependent DNA helicase rep.)

SCOPe Domain Sequences for d1uaaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]}
rlnpgqqqavefvtgpclvlagagsgktrvitnkiahlirgcgyqarhiaavtftnkaar
emkervgqtlgrkearglmistfhtlgldiikreyaalgmkanfslfddtdqlallkelt
eglieddkvllqqlistisnwkndlktpsqaaasaigerdrifahcyglydahlkacnvl
dfddlillptlllqaneevrkrwqnkiryllvdeyqdtntsqyelvkllvgsrarftvvg
dddqsiyswrgarpqnlvllsqdfpalkvikleqnyrssgrilkaaniliannphvfekr
lfselg

SCOPe Domain Coordinates for d1uaaa1:

Click to download the PDB-style file with coordinates for d1uaaa1.
(The format of our PDB-style files is described here.)

Timeline for d1uaaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uaaa2