Lineage for d5k22a_ (5k22 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130872Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2130873Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2130874Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)
  6. 2130932Protein automated matches [190696] (3 species)
    not a true protein
  7. 2130933Species Human (Homo sapiens) [TaxId:9606] [188122] (15 PDB entries)
  8. 2130971Domain d5k22a_: 5k22 A: [323982]
    automated match to d2mbca_

Details for d5k22a_

PDB Entry: 5k22 (more details), 3 Å

PDB Description: crystal structure of the complex between human prl-2 phosphatase in reduced state and bateman domain of human cnnm3
PDB Compounds: (A:) Protein tyrosine phosphatase type IVA 2

SCOPe Domain Sequences for d5k22a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k22a_ c.45.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mnrpapveisyenmrflithnptnatlnkfteelkkygvttlvrvcdatydkapvekegi
hvldwpfddgapppnqivddwlnllktkfreepgaavavhcvaglgrapvlvalalieag
mkyedavqfirqkrrgafnskqllylekyrpkmrlr

SCOPe Domain Coordinates for d5k22a_:

Click to download the PDB-style file with coordinates for d5k22a_.
(The format of our PDB-style files is described here.)

Timeline for d5k22a_: