![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
![]() | Protein automated matches [190131] (86 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [315489] (3 PDB entries) |
![]() | Domain d5i4ca_: 5i4c A: [323912] automated match to d3cz5a_ |
PDB Entry: 5i4c (more details), 2 Å
SCOPe Domain Sequences for d5i4ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i4ca_ c.23.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]} nnmnviiaddhpivlfgirksleqiewvnvvgefedstalinnlpkldahvlitdlsmpg dkygdgitlikyikrhfpslsiivltmnnnpailsavldldiegivlkqgaptdlpkala alqkgkkftpe
Timeline for d5i4ca_: