Lineage for d5i4ca_ (5i4c A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2114716Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2115095Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2115096Protein automated matches [190131] (71 species)
    not a true protein
  7. 2115227Species Escherichia coli [TaxId:83333] [315489] (3 PDB entries)
  8. 2115231Domain d5i4ca_: 5i4c A: [323912]
    automated match to d3cz5a_

Details for d5i4ca_

PDB Entry: 5i4c (more details), 2 Å

PDB Description: crystal structure of non-phosphorylated receiver domain of the stress response regulator rcsb from escherichia coli
PDB Compounds: (A:) Transcriptional regulatory protein RcsB

SCOPe Domain Sequences for d5i4ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i4ca_ c.23.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
nnmnviiaddhpivlfgirksleqiewvnvvgefedstalinnlpkldahvlitdlsmpg
dkygdgitlikyikrhfpslsiivltmnnnpailsavldldiegivlkqgaptdlpkala
alqkgkkftpe

SCOPe Domain Coordinates for d5i4ca_:

Click to download the PDB-style file with coordinates for d5i4ca_.
(The format of our PDB-style files is described here.)

Timeline for d5i4ca_: