Lineage for d5e5mg_ (5e5m G:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2354752Protein Immunoreceptor CTLA-4 (CD152), N-terminal fragment [48939] (2 species)
  7. 2354764Species Mouse (Mus musculus) [TaxId:10090] [48941] (3 PDB entries)
  8. 2354773Domain d5e5mg_: 5e5m G: [323902]
    Other proteins in same PDB: d5e5mb_, d5e5md_, d5e5mf_, d5e5mh_
    automated match to d1dqta_
    complexed with gol

Details for d5e5mg_

PDB Entry: 5e5m (more details), 2.18 Å

PDB Description: crystal structure of mouse ctla-4 in complex with nanobody
PDB Compounds: (G:) cytotoxic t-lymphocyte protein 4

SCOPe Domain Sequences for d5e5mg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e5mg_ b.1.1.1 (G:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]}
iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvid

SCOPe Domain Coordinates for d5e5mg_:

Click to download the PDB-style file with coordinates for d5e5mg_.
(The format of our PDB-style files is described here.)

Timeline for d5e5mg_: