Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
Protein Smc head domain [52693] (3 species) |
Species Thermotoga maritima [TaxId:2336] [52694] (1 PDB entry) |
Domain d1e69f_: 1e69 F: [32381] N- and C-terminal subdomains only; the middle coiled coil domain is deleted |
PDB Entry: 1e69 (more details), 3.1 Å
SCOPe Domain Sequences for d1e69f_:
Sequence, based on SEQRES records: (download)
>d1e69f_ c.37.1.12 (F:) Smc head domain {Thermotoga maritima [TaxId: 2336]} mrlkklylkgfksfgrpsligfsdrvtaivgpngsgksniidaikwvfgeqskkelrase kfdmifagsenlppagsayvelvfeengeeitvarelkrtgentyylngspvrlkdirdr fagtglgvdfysivgqgqidrivnaspeelrlesskhptslvprgsyqrvnesfnrfisl lffggegrlnivseaksildagfeisirkpgrrdqklsllsggekalvglallfalmeik pspfyvldevdsplddynaerfkrllkenskhtqfivithnkivmeaadllhgvtmvngv saivpvev
>d1e69f_ c.37.1.12 (F:) Smc head domain {Thermotoga maritima [TaxId: 2336]} mrlkklylkgfksfgrpsligfsdrvtaivgpngsgksniidaikwvfgekfdmifagse nlppagsayvelvfeengeeitvarelkrtgentyylngspvrlkdirdrfagtglgvdf ysivgqgqidrivnayqrvnesfnrfisllffggegrleisirkpgrrdqklsllsggek alvglallfalmeikpspfyvldevdsplddynaerfkrllkenskhtqfivithnkivm eaadllhgvtmvngvsaivpvev
Timeline for d1e69f_: