Class b: All beta proteins [48724] (178 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (49 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries) |
Domain d5jxga2: 5jxg A:443-574 [323735] Other proteins in same PDB: d5jxga1, d5jxga3 automated match to d1p8ja1 complexed with ca, cl, na |
PDB Entry: 5jxg (more details), 1.8 Å
SCOPe Domain Sequences for d5jxga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jxga2 b.18.1.0 (A:443-574) automated matches {Human (Homo sapiens) [TaxId: 9606]} tvapqrkciidiltepkdigkrlevrktvtaclgepnhitrlehaqarltlsynrrgdla ihlvspmgtrstllaarphdysadgfndwafmtthswdedpsgewvleientseannygt ltkftlvlygta
Timeline for d5jxga2: