Lineage for d5jxga2 (5jxg A:443-574)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384653Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2384654Protein automated matches [190770] (49 species)
    not a true protein
  7. 2384921Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries)
  8. 2384929Domain d5jxga2: 5jxg A:443-574 [323735]
    Other proteins in same PDB: d5jxga1, d5jxga3
    automated match to d1p8ja1
    complexed with ca, cl, na

Details for d5jxga2

PDB Entry: 5jxg (more details), 1.8 Å

PDB Description: structure of the unliganded form of the proprotein convertase furin.
PDB Compounds: (A:) Furin

SCOPe Domain Sequences for d5jxga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jxga2 b.18.1.0 (A:443-574) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvapqrkciidiltepkdigkrlevrktvtaclgepnhitrlehaqarltlsynrrgdla
ihlvspmgtrstllaarphdysadgfndwafmtthswdedpsgewvleientseannygt
ltkftlvlygta

SCOPe Domain Coordinates for d5jxga2:

Click to download the PDB-style file with coordinates for d5jxga2.
(The format of our PDB-style files is described here.)

Timeline for d5jxga2: