SCOPe 2.07: Domain d5kq1e2: 5kq1 E:95-241

Lineage for d5kq1e2 (5kq1 E:95-241)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.7: mRNA decapping enzyme-like [143777] (2 proteins)
   part of Pfam PF00293

6. Protein automated matches [231207] (2 species)
   not a true protein

7. Species Schizosaccharomyces pombe [TaxId:284812] [323649] (2 PDB entries)

8. Domain d5kq1e2: 5kq1 E:95-241 [323653]
   Other proteins in same PDB: d5kq1b1, d5kq1b3, d5kq1e1, d5kq1e3
   automated match to d2a6ta2
   protein/RNA complex

Details for d5kq1e2

PDB Entry: 5kq1, 3 Å

PDB Description: crystal structure of s. pombe dcp1/dcp2 in complex with h. sapiens pnrc2

PDB Compounds: (E:) mRNA decapping complex subunit 2

SCOPe Domain Sequences for d5kq1e2:

Sequence, based on SEQRES records:

>d5kq1e2 d.113.1.7 (E:95-241) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
ripvrgaimldmsmqqcvlvkgwkassgwgfpkgkidkdesdvdcairevyeetgfdcss
rinpnefidmtirgqnvrlyiipgisldtrfesrtrkeiskiewhnlmdlptfkknkpqt
mknkfymvipflaplkkwikkrniann

Sequence, based on observed residues (ATOM records):

>d5kq1e2 d.113.1.7 (E:95-241) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
ripvrgaimldmsmqqcvlvkgwkassgwgfpkgkidkdesdvdcairevyeetgfdcss
rinpnefidmtirgqnvrlyiipgisldtrfesrteiskiewhnlmdlptfkknkmknkf
ymvipflaplkkwikkrniann

Timeline for d5kq1e2:

• d5kq1e2 first appeared in SCOPe 2.06
  
• d5kq1e2 appears in the current release, SCOPe 2.08