Lineage for d5j7wd_ (5j7w D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2579104Protein automated matches [190469] (17 species)
    not a true protein
  7. 2579131Species Enterococcus faecalis [TaxId:1351] [194752] (5 PDB entries)
  8. 2579147Domain d5j7wd_: 5j7w D: [323368]
    automated match to d3uwlb_
    complexed with mtx, so4

Details for d5j7wd_

PDB Entry: 5j7w (more details), 2.5 Å

PDB Description: enterococcus faecalis thymidylate synthase complex with methotrexate
PDB Compounds: (D:) Thymidylate synthase

SCOPe Domain Sequences for d5j7wd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j7wd_ d.117.1.1 (D:) automated matches {Enterococcus faecalis [TaxId: 1351]}
meeaylalgkkileeghfkedrtgtgtyslfgyqmrfdlakgfpllttkrvpfgliksel
lwflkgdtniryllernnhiwdewaferyvksadyqgpdmtdfghrvlqdpafaeqykee
hqkfcdailndaefaekygelgniygaqwrhwetkdgsfidqlanviemiktnpdsrrli
vsawnpedvpsmalppchtmfqfyvnegklscqlyqrsadvflgvpfniasyallthlia
hetglevgefvhtlgdahlyqnhveqmqeqlsrevrsfptlvlnpdkasvfdfdmedikv
egydphptikapiav

SCOPe Domain Coordinates for d5j7wd_:

Click to download the PDB-style file with coordinates for d5j7wd_.
(The format of our PDB-style files is described here.)

Timeline for d5j7wd_: