Lineage for d5c9mb_ (5c9m B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980707Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1981148Protein automated matches [190113] (17 species)
    not a true protein
  7. 1981194Species Rattus norvegicus [TaxId:10116] [322473] (3 PDB entries)
  8. 1981204Domain d5c9mb_: 5c9m B: [322991]
    automated match to d2b4za_
    complexed with fc6, hec

Details for d5c9mb_

PDB Entry: 5c9m (more details), 1.36 Å

PDB Description: the structure of oxidized rat cytochrome c (t28a) at 1.362 angstroms resolution.
PDB Compounds: (B:) Cytochrome c, somatic

SCOPe Domain Sequences for d5c9mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c9mb_ a.3.1.1 (B:) automated matches {Rattus norvegicus [TaxId: 10116]}
gdvekgkkifvqkcaqchtvekggkhkagpnlhglfgrktgqaagfsytdanknkgitwg
edtlmeylenpkkyipgtkmifagikkkgeradliaylkkatne

SCOPe Domain Coordinates for d5c9mb_:

Click to download the PDB-style file with coordinates for d5c9mb_.
(The format of our PDB-style files is described here.)

Timeline for d5c9mb_: