SCOPe 2.07: Domain d5eoeb_: 5eoe B:

Lineage for d5eoeb_ (5eoe B:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [189201] (31 PDB entries)

8. Domain d5eoeb_: 5eoe B: [322884]
   automated match to d4mxga_
   complexed with 1pe, cit, cl, edo, ipa, mrd, pge

Details for d5eoeb_

PDB Entry: 5eoe, 1.6 Å

PDB Description: crystal structure of extended-spectrum beta-lactamase bel-1 (orthorhombic form)

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5eoeb_:

Sequence; same for both SEQRES and ATOM records:

>d5eoeb_ e.3.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dfehaisdleahnqakigvalvsengnliqgyranerfamcstfklplaalvlsridage
enperklhydsafleeyapaakryvatgymtvteaiqsalqlsdnaaanlllkevggppl
ltkyfrslgdkvsrldrieptlntntpgderdtttpmsmaqtvsklifgdtltykskgql
rrllignqtgdktiraglpdswvtgdktgscanggrndvaffittagkkyvlsvytnape
lqgeeralliasvaklarqyv

Timeline for d5eoeb_:

• d5eoeb_ first appeared in SCOPe 2.06
  
• d5eoeb_ appears in the current release, SCOPe 2.08