Lineage for d2ffha3 (2ffh A:89-307)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484706Family c.37.1.10: Nitrogenase iron protein-like [52652] (11 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 484818Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)
  7. 484829Species Thermus aquaticus [TaxId:271] [52665] (11 PDB entries)
  8. 484843Domain d2ffha3: 2ffh A:89-307 [32276]
    Other proteins in same PDB: d2ffha1, d2ffha2, d2ffhb1, d2ffhb2, d2ffhc1, d2ffhc2

Details for d2ffha3

PDB Entry: 2ffh (more details), 3.2 Å

PDB Description: the signal sequence binding protein ffh from thermus aquaticus

SCOP Domain Sequences for d2ffha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ffha3 c.37.1.10 (A:89-307) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmgdvaslaekvraa

SCOP Domain Coordinates for d2ffha3:

Click to download the PDB-style file with coordinates for d2ffha3.
(The format of our PDB-style files is described here.)

Timeline for d2ffha3: