Lineage for d2ffha3 (2ffh A:89-307)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23415Family c.37.1.10: Nitrogenase iron protein-like [52652] (7 proteins)
  6. 23475Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (1 species)
  7. 23476Species Thermus aquaticus [TaxId:271] [52665] (5 PDB entries)
  8. 23482Domain d2ffha3: 2ffh A:89-307 [32276]
    Other proteins in same PDB: d2ffha1, d2ffha2, d2ffhb1, d2ffhb2, d2ffhc1, d2ffhc2

Details for d2ffha3

PDB Entry: 2ffh (more details), 3.2 Å

PDB Description: the signal sequence binding protein ffh from thermus aquaticus

SCOP Domain Sequences for d2ffha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ffha3 c.37.1.10 (A:89-307) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmgdvaslaekvraa

SCOP Domain Coordinates for d2ffha3:

Click to download the PDB-style file with coordinates for d2ffha3.
(The format of our PDB-style files is described here.)

Timeline for d2ffha3: