Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species) |
Species Thermus aquaticus [TaxId:271] [52665] (18 PDB entries) |
Domain d1ng1a2: 1ng1 A:89-294 [32272] Other proteins in same PDB: d1ng1a1 complexed with acy, cd, edo, gdp, mg |
PDB Entry: 1ng1 (more details), 2.03 Å
SCOPe Domain Sequences for d1ng1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ng1a2 c.37.1.10 (A:89-294) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy fagvsekpeglepfyperlagrilgm
Timeline for d1ng1a2: