Lineage for d5hw7b_ (5hw7 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548393Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2548394Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2548747Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2548748Protein automated matches [191162] (29 species)
    not a true protein
  7. 2548767Species Candida albicans [TaxId:237561] [322564] (6 PDB entries)
  8. 2548771Domain d5hw7b_: 5hw7 B: [322598]
    automated match to d4iq2a_

Details for d5hw7b_

PDB Entry: 5hw7 (more details), 2.29 Å

PDB Description: candida albicans fkbp12 apo protein in p21212 space group
PDB Compounds: (B:) FK506-binding protein 1

SCOPe Domain Sequences for d5hw7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hw7b_ d.26.1.0 (B:) automated matches {Candida albicans [TaxId: 237561]}
elpqieivqegdnttfakpgdtvtihydgkltngkefdssrkrgkpftctvgvgqvikgw
disltnnygkgganlpkiskgtkailtippnlaygprgippiigpnetlvfevellgvn

SCOPe Domain Coordinates for d5hw7b_:

Click to download the PDB-style file with coordinates for d5hw7b_.
(The format of our PDB-style files is described here.)

Timeline for d5hw7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5hw7a_