Lineage for d5hwba_ (5hwb A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185704Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2185705Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2186026Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2186027Protein automated matches [191162] (27 species)
    not a true protein
  7. 2186116Species Neosartorya fumigata [TaxId:330879] [322576] (2 PDB entries)
  8. 2186118Domain d5hwba_: 5hwb A: [322591]
    Other proteins in same PDB: d5hwbb2
    automated match to d5b8ic_
    complexed with so4

Details for d5hwba_

PDB Entry: 5hwb (more details), 2.31 Å

PDB Description: aspergillus fumigatus fkbp12 apo protein in p212121 space group
PDB Compounds: (A:) FK506-binding protein 1A

SCOPe Domain Sequences for d5hwba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hwba_ d.26.1.0 (A:) automated matches {Neosartorya fumigata [TaxId: 330879]}
mgvtkelkspgngvdfpkkgdfvtihytgrltdgskfdssvdrnepfqtqigtgrvikgw
degvpqmslgekavltitpdygygargfppvipgnstlifevellginnkr

SCOPe Domain Coordinates for d5hwba_:

Click to download the PDB-style file with coordinates for d5hwba_.
(The format of our PDB-style files is described here.)

Timeline for d5hwba_: