Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (27 species) not a true protein |
Species Neosartorya fumigata [TaxId:330879] [322576] (2 PDB entries) |
Domain d5hwba_: 5hwb A: [322591] Other proteins in same PDB: d5hwbb2 automated match to d5b8ic_ complexed with so4 |
PDB Entry: 5hwb (more details), 2.31 Å
SCOPe Domain Sequences for d5hwba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hwba_ d.26.1.0 (A:) automated matches {Neosartorya fumigata [TaxId: 330879]} mgvtkelkspgngvdfpkkgdfvtihytgrltdgskfdssvdrnepfqtqigtgrvikgw degvpqmslgekavltitpdygygargfppvipgnstlifevellginnkr
Timeline for d5hwba_: