Lineage for d2nipb_ (2nip B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 394266Family c.37.1.10: Nitrogenase iron protein-like [52652] (10 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 394404Protein Nitrogenase iron protein [52661] (2 species)
  7. 394405Species Azotobacter vinelandii [TaxId:354] [52662] (12 PDB entries)
  8. 394413Domain d2nipb_: 2nip B: [32252]
    complexed with fs4

Details for d2nipb_

PDB Entry: 2nip (more details), 2.2 Å

PDB Description: nitrogenase iron protein from azotobacter vinelandii

SCOP Domain Sequences for d2nipb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nipb_ c.37.1.10 (B:) Nitrogenase iron protein {Azotobacter vinelandii}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev

SCOP Domain Coordinates for d2nipb_:

Click to download the PDB-style file with coordinates for d2nipb_.
(The format of our PDB-style files is described here.)

Timeline for d2nipb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2nipa_