Lineage for d5dqlb_ (5dql B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2446508Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2446707Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (4 proteins)
    forms a swapped dimer
  6. 2446731Protein Isocitrate lyase [51642] (5 species)
    elaborated with additional subdomains
  7. 2446750Species Mycobacterium tuberculosis [TaxId:652616] [322477] (5 PDB entries)
  8. 2446760Domain d5dqlb_: 5dql B: [322478]
    automated match to d1f8ia_
    complexed with mg, vgx

Details for d5dqlb_

PDB Entry: 5dql (more details), 1.78 Å

PDB Description: crystal structure of 2-vinyl glyoxylate modified isocitrate lyase from mycobacterium tuberculosis
PDB Compounds: (B:) Isocitrate lyase 1

SCOPe Domain Sequences for d5dqlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dqlb_ c.1.12.7 (B:) Isocitrate lyase {Mycobacterium tuberculosis [TaxId: 652616]}
msvvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweql
hdlewvnalgaltgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpqv
vrrinnalqradqiakiegdtsvenwlapivadgeagfggalnvyelqkaliaagvagsh
wedqlasekkcghlggkvliptqqhirtltsarlaadvadvptvviartdaeaatlitsd
vderdqpfitgertregfyrtkngiepciarakayapfadliwmetgtpdleaarqfsea
vkaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqfitlagfhalnysmfd
laygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnssttaltg
steegqf

SCOPe Domain Coordinates for d5dqlb_:

Click to download the PDB-style file with coordinates for d5dqlb_.
(The format of our PDB-style files is described here.)

Timeline for d5dqlb_: