Lineage for d1fp6a_ (1fp6 A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) 
Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins) 
Protein Nitrogenase iron protein [52661] (2 species) 
Species Azotobacter vinelandii [TaxId:354] [52662] (9 PDB entries) 
Domain d1fp6a_: 1fp6 A: [32243]
Details for d1fp6a_
PDB Entry: 1fp6 (more details), 2.15 Å
PDB Description: the nitrogenase fe protein from azotobacter vinelandii complexed with mgadp
SCOP Domain Sequences for d1fp6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fp6a_ c.37.1.10 (A:) Nitrogenase iron protein {Azotobacter vinelandii}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
SCOP Domain Coordinates for d1fp6a_:
Click to download the PDB-style file with coordinates for d1fp6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fp6a_:
- d1fp6a_ first appeared (with stable ids) in SCOP 1.55
- d1fp6a_ appears in SCOP 1.59
- d1fp6a_ appears in SCOP 1.63
- d1fp6a_ appears in the current release, SCOPe 2.08
View in 3D
