Lineage for d5sxsb2 (5sxs B:444-748)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2720495Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
    duplication: tandem repeat of two CCP-like domains
  6. 2720496Protein Catalase-peroxidase KatG [74754] (6 species)
    only the N-terminal CCP-like domain binds heme
  7. 2720509Species Burkholderia pseudomallei [TaxId:320372] [321159] (45 PDB entries)
  8. 2720625Domain d5sxsb2: 5sxs B:444-748 [322345]
    automated match to d3n3ra2
    complexed with amp, cl, hem, mpd, mrd, na, niz, oxy, po4

Details for d5sxsb2

PDB Entry: 5sxs (more details), 1.89 Å

PDB Description: crystal structure of catalase-peroxidase katg with isonicotinic acid hydrazide and amp bound
PDB Compounds: (B:) Catalase-peroxidase

SCOPe Domain Sequences for d5sxsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5sxsb2 a.93.1.3 (B:444-748) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 320372]}
llwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgganga
rirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaa
knaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaql
ltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadad
vfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnld
rfdla

SCOPe Domain Coordinates for d5sxsb2:

Click to download the PDB-style file with coordinates for d5sxsb2.
(The format of our PDB-style files is described here.)

Timeline for d5sxsb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5sxsb1