Lineage for d5t02e_ (5t02 E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2551373Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2551374Protein automated matches [190143] (41 species)
    not a true protein
  7. 2551544Species Neisseria meningitidis [TaxId:272831] [193287] (8 PDB entries)
  8. 2551573Domain d5t02e_: 5t02 E: [322296]
    automated match to d4iena_
    complexed with cl, coa, gdp; mutant

Details for d5t02e_

PDB Entry: 5t02 (more details), 2.8 Å

PDB Description: structural characterisation of mutant asp39ala of thioesterase (nmach) from neisseria meningitidis
PDB Compounds: (E:) acyl-CoA hydrolase

SCOPe Domain Sequences for d5t02e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t02e_ d.38.1.0 (E:) automated matches {Neisseria meningitidis [TaxId: 272831]}
rqlpshelimselmmpdtanfsgnvhggelllllaqvayscasrysgnycvtlsvdkvlf
kepihigdlvtfyaavnytgrtsmeigirveaqnirtgeirhtnscyftmvavkdgkpvp
vppleiltdrqrcryekakkrrdislq

SCOPe Domain Coordinates for d5t02e_:

Click to download the PDB-style file with coordinates for d5t02e_.
(The format of our PDB-style files is described here.)

Timeline for d5t02e_: