Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.6: PMT1231-like [158402] (2 proteins) PfamB PB016165 automatically mapped to Pfam PF11266 |
Protein automated matches [261918] (4 species) not a true protein |
Species Oscillatoria sp. [TaxId:1159] [322221] (1 PDB entry) |
Domain d5k53a_: 5k53 A: [322222] automated match to d4kvqa_ complexed with fe, ste |
PDB Entry: 5k53 (more details), 1.8 Å
SCOPe Domain Sequences for d5k53a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k53a_ a.25.1.6 (A:) automated matches {Oscillatoria sp. [TaxId: 1159]} idfqtetykdaysrinaiviegeqeahdnyltlaelladkkaelvglskmenrhmkgfqa cgrnlkvtpdmafakqffselhknfqtaaaqgqivtclliqsliiecfaiaayniyipva ddfarkitegvvkeeyshlnfgevwlqahfeeskaeleaanrqnlpiiwkllnavaddar vlgmekdaliedfmiaygealgnigfnnrdimrmsaq
Timeline for d5k53a_: