SCOPe 2.06: Domain d5k53a_: 5k53 A:

Lineage for d5k53a_ (5k53 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.6: PMT1231-like [158402] (2 proteins)
   PfamB PB016165
   automatically mapped to Pfam PF11266

6. Protein automated matches [261918] (4 species)
   not a true protein

7. Species Oscillatoria sp. [TaxId:1159] [322221] (1 PDB entry)

8. Domain d5k53a_: 5k53 A: [322222]
   automated match to d4kvqa_
   complexed with fe, ste

Details for d5k53a_

PDB Entry: 5k53, 1.8 Å

PDB Description: crystal structures of aldehyde deformylating oxygenase from oscillatoria sp. knua011

PDB Compounds: (A:) aldehyde deformylating oxygenase

SCOPe Domain Sequences for d5k53a_:

Sequence; same for both SEQRES and ATOM records:

>d5k53a_ a.25.1.6 (A:) automated matches {Oscillatoria sp. [TaxId: 1159]}
idfqtetykdaysrinaiviegeqeahdnyltlaelladkkaelvglskmenrhmkgfqa
cgrnlkvtpdmafakqffselhknfqtaaaqgqivtclliqsliiecfaiaayniyipva
ddfarkitegvvkeeyshlnfgevwlqahfeeskaeleaanrqnlpiiwkllnavaddar
vlgmekdaliedfmiaygealgnigfnnrdimrmsaq

Timeline for d5k53a_:

• d5k53a_ is new in SCOPe 2.06-stable
  
• d5k53a_ appears in SCOPe 2.07
  
• d5k53a_ appears in the current release, SCOPe 2.08