Lineage for d5fhta2 (5fht A:225-325)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2786490Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2786491Protein automated matches [190436] (9 species)
    not a true protein
  7. 2786505Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries)
  8. 2786618Domain d5fhta2: 5fht A:225-325 [322170]
    Other proteins in same PDB: d5fhta1, d5fhta3
    automated match to d1lcya1
    complexed with cl, k, mes, na; mutant

Details for d5fhta2

PDB Entry: 5fht (more details), 1.95 Å

PDB Description: htra2 protease mutant v226k
PDB Compounds: (A:) Serine protease HTRA2, mitochondrial

SCOPe Domain Sequences for d5fhta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fhta2 b.36.1.0 (A:225-325) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvilaig
eqmvqnaedvyeavrtqsqlavqirrgretltlyvtpevte

SCOPe Domain Coordinates for d5fhta2:

Click to download the PDB-style file with coordinates for d5fhta2.
(The format of our PDB-style files is described here.)

Timeline for d5fhta2: