Lineage for d1lcya1 (1lcy A:226-325)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2786418Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins)
  6. 2786419Protein Mitochondrial serine protease HtrA2 [74936] (1 species)
  7. 2786420Species Human (Homo sapiens) [TaxId:9606] [74937] (1 PDB entry)
  8. 2786421Domain d1lcya1: 1lcy A:226-325 [73834]
    Other proteins in same PDB: d1lcya2

Details for d1lcya1

PDB Entry: 1lcy (more details), 2 Å

PDB Description: crystal structure of the mitochondrial serine protease htra2
PDB Compounds: (A:) HtrA2 serine protease

SCOPe Domain Sequences for d1lcya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]}
rryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvilaige
qmvqnaedvyeavrtqsqlavqirrgretltlyvtpevte

SCOPe Domain Coordinates for d1lcya1:

Click to download the PDB-style file with coordinates for d1lcya1.
(The format of our PDB-style files is described here.)

Timeline for d1lcya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lcya2