Lineage for d1lcya2 (1lcy A:6-210)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055631Family b.47.1.1: Prokaryotic proteases [50495] (16 protein domains)
  6. 2055706Protein Mitochondrial serine protease HtrA2, catalytic domain [74971] (1 species)
  7. 2055707Species Human (Homo sapiens) [TaxId:9606] [74972] (1 PDB entry)
  8. 2055708Domain d1lcya2: 1lcy A:6-210 [73835]
    Other proteins in same PDB: d1lcya1

Details for d1lcya2

PDB Entry: 1lcy (more details), 2 Å

PDB Description: Crystal Structure of the Mitochondrial Serine Protease HtrA2
PDB Compounds: (A:) HtrA2 serine protease

SCOPe Domain Sequences for d1lcya2:

Sequence, based on SEQRES records: (download)

>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
ppasprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnah
vvadrrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvv
amgspfalqntitsgivssaqrpardlglpqtnveyiqtdaaidfgnaggplvnldgevi
gvntmkvtagisfaipsdrlreflh

Sequence, based on observed residues (ATOM records): (download)

>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
ppasprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnah
vvadrrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvv
amgspfalqntitsgivssaqrpnveyiqtdaaidfgnaggplvnldgevigvntmkvta
gisfaipsdrlreflh

SCOPe Domain Coordinates for d1lcya2:

Click to download the PDB-style file with coordinates for d1lcya2.
(The format of our PDB-style files is described here.)

Timeline for d1lcya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lcya1