Lineage for d1hooa_ (1hoo A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 582486Family c.37.1.10: Nitrogenase iron protein-like [52652] (11 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 582487Protein Adenylosuccinate synthetase, PurA [52655] (5 species)
    common fold is interrupted by an all-alpha subdomain, residues 100-200
  7. 582491Species Escherichia coli [TaxId:562] [52656] (23 PDB entries)
  8. 582511Domain d1hooa_: 1hoo A: [32217]

Details for d1hooa_

PDB Entry: 1hoo (more details), 2.3 Å

PDB Description: structure of guanine nucleotide (gppcp) complex of adenylosuccinate synthetase from e. coli at ph 6.5 and 25 degrees celsius

SCOP Domain Sequences for d1hooa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hooa_ c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Escherichia coli}
gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil
renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka
rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea
vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts
snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat
tgrrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl
aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt
etmilrdpfda

SCOP Domain Coordinates for d1hooa_:

Click to download the PDB-style file with coordinates for d1hooa_.
(The format of our PDB-style files is described here.)

Timeline for d1hooa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hoob_