Lineage for d1a82__ (1a82 -)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) 
Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins) Protein Dethiobiotin synthetase [52653] (1 species) Species Escherichia coli [TaxId:562] [52654] (13 PDB entries) 
Domain d1a82__: 1a82 - [32211]
Details for d1a82__
PDB Entry: 1a82 (more details), 1.8 Å
PDB Description: dethiobiotin synthetase from escherichia coli, complex with substrates atp and diaminopelargonic acid
SCOP Domain Sequences for d1a82__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a82__ c.37.1.10 (-) Dethiobiotin synthetase {Escherichia coli}
skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr
nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw
ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp
gkrhaeymttltrmipapllgeipwlaenpenaatgkyinlall
SCOP Domain Coordinates for d1a82__:
Click to download the PDB-style file with coordinates for d1a82__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a82__:
- d1a82__ first appeared (with stable ids) in SCOP 1.55
- d1a82__ appears in SCOP 1.59
- d1a82__ appears in SCOP 1.63
- d1a82__ appears in the current release, SCOPe 2.08, called d1a82a_
View in 3D