Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) |
Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins) |
Protein Dethiobiotin synthetase [52653] (1 species) |
Species Escherichia coli [TaxId:562] [52654] (13 PDB entries) |
Domain d1a82__: 1a82 - [32211] |
PDB Entry: 1a82 (more details), 1.8 Å
SCOP Domain Sequences for d1a82__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a82__ c.37.1.10 (-) Dethiobiotin synthetase {Escherichia coli} skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp gkrhaeymttltrmipapllgeipwlaenpenaatgkyinlall
Timeline for d1a82__: