SCOP 1.65: Domain d1dama_: 1dam A:

Lineage for d1dama_ (1dam A:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (10 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Dethiobiotin synthetase [52653] (1 species)

7. Species Escherichia coli [TaxId:562] [52654] (13 PDB entries)

8. Domain d1dama_: 1dam A: [32210]
   complexed with adp, cyc, ium, pho

Details for d1dama_

PDB Entry: 1dam, 1.8 Å

PDB Description: dethiobiotin synthetase complexed with dethiobiotin, adp, inorganic phosphate and magnesium

SCOP Domain Sequences for d1dama_:

Sequence; same for both SEQRES and ATOM records:

>d1dama_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli}
skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr
nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw
ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp
gkrhaeymttltrmipapllgeipwlaenpenaatgkyinlall

Timeline for d1dama_:

• d1dama_ first appeared (with stable ids) in SCOP 1.55
  
• d1dama_ appears in SCOP 1.63
  
• d1dama_ appears in SCOP 1.67
  
• d1dama_ appears in the current release, SCOPe 2.08