Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) division into families based on beta-sheet topologies |
Family c.37.1.10: Nitrogenase iron protein-like [52652] (10 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
Protein Dethiobiotin synthetase [52653] (1 species) |
Species Escherichia coli [TaxId:562] [52654] (13 PDB entries) |
Domain d1dae__: 1dae - [32205] complexed with ikt |
PDB Entry: 1dae (more details), 1.7 Å
SCOP Domain Sequences for d1dae__:
Sequence, based on SEQRES records: (download)
>d1dae__ c.37.1.10 (-) Dethiobiotin synthetase {Escherichia coli} skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp gkrhaeymttltrmipapllgeipwlaenpenaatgkyinlall
>d1dae__ c.37.1.10 (-) Dethiobiotin synthetase {Escherichia coli} skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp gkrhaeymttltrmipapllgeipwlaaatgkyinlall
Timeline for d1dae__: