SCOP 1.67: Domain d1dae__: 1dae -

Lineage for d1dae__ (1dae -)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (10 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Dethiobiotin synthetase [52653] (1 species)

7. Species Escherichia coli [TaxId:562] [52654] (13 PDB entries)

8. Domain d1dae__: 1dae - [32205]
   complexed with ikt

Details for d1dae__

PDB Entry: 1dae, 1.7 Å

PDB Description: dethiobiotin synthetase complexed with 3-(1-aminoethyl) nonanedioic acid

SCOP Domain Sequences for d1dae__:

Sequence, based on SEQRES records:

>d1dae__ c.37.1.10 (-) Dethiobiotin synthetase {Escherichia coli}
skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr
nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw
ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp
gkrhaeymttltrmipapllgeipwlaenpenaatgkyinlall

Sequence, based on observed residues (ATOM records):

>d1dae__ c.37.1.10 (-) Dethiobiotin synthetase {Escherichia coli}
skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr
nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw
ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp
gkrhaeymttltrmipapllgeipwlaaatgkyinlall

Timeline for d1dae__:

• d1dae__ first appeared (with stable ids) in SCOP 1.55
  
• d1dae__ appears in SCOP 1.65
  
• d1dae__ appears in SCOP 1.69
  
• d1dae__ appears in the current release, SCOPe 2.08, called d1daea_