Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) |
Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins) |
Protein Dethiobiotin synthetase [52653] (1 species) |
Species Escherichia coli [TaxId:562] [52654] (13 PDB entries) |
Domain d1daka_: 1dak A: [32203] |
PDB Entry: 1dak (more details), 1.6 Å
SCOP Domain Sequences for d1daka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1daka_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli} skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp gkrhaeymttltrmipapllgeipwlaenpenaatgkyinlall
Timeline for d1daka_: