Lineage for d5duqb_ (5duq B:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618031Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2618032Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2618256Family e.1.1.0: automated matches [191406] (1 protein)
    not a true family
  6. 2618257Protein automated matches [190555] (14 species)
    not a true protein
  7. 2618286Species Human (Homo sapiens) [TaxId:9606] [187538] (16 PDB entries)
  8. 2618314Domain d5duqb_: 5duq B: [321978]
    automated match to d2oaya1
    complexed with bgc, glc, nag, so3

Details for d5duqb_

PDB Entry: 5duq (more details), 2.9 Å

PDB Description: active human c1-inhibitor in complex with dextran sulfate
PDB Compounds: (B:) Plasma protease C1 inhibitor

SCOPe Domain Sequences for d5duqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5duqb_ e.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eshsteavlgdalvdfslklyhafsamkkvetnmafspfsiaslltqvllgagentktnl
esilsypkdftcvhqalkgfttkgvtsvsqifhspdlairdtfvnasrtlysssprvlsn
nsdanlelintwvakntnnkisrlldslpsdtrlvllnaiylsakwkttfdpkktrmepf
hfknsvikvpmmnskkypvahfidqtlkakvgqlqlshnlslvilvpqnlkhrledmeqa
lspsvfkaimeklemskfqptlltlprikvttsqdmlsimekleffdfsydlnlcglted
pdlqvsamqhqtvleltetgveaaaasaisvartllvfevqqpflfmlwdqqhkfpvfmg
rvydp

SCOPe Domain Coordinates for d5duqb_:

Click to download the PDB-style file with coordinates for d5duqb_.
(The format of our PDB-style files is described here.)

Timeline for d5duqb_: