Lineage for d5f35a1 (5f35 A:1-298)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2530790Fold c.145: NadA-like [142753] (1 superfamily)
    duplication; consists of three similar domains related by pseudo threefold symmetry; 3 layers, a/b/a; parallel beta sheet, order: 2134
  4. 2530791Superfamily c.145.1: NadA-like [142754] (2 families) (S)
    automatically mapped to Pfam PF02445
  5. 2530811Family c.145.1.0: automated matches [238306] (1 protein)
    not a true family
  6. 2530812Protein automated matches [238307] (1 species)
    not a true protein
  7. 2530813Species Thermotoga maritima [TaxId:243274] [238308] (13 PDB entries)
  8. 2530816Domain d5f35a1: 5f35 A:1-298 [321886]
    Other proteins in same PDB: d5f35a2
    automated match to d4p3xa_
    complexed with flc, mg, sf4

Details for d5f35a1

PDB Entry: 5f35 (more details), 1.6 Å

PDB Description: structure of quinolinate synthase in complex with citrate
PDB Compounds: (A:) Quinolinate synthase A

SCOPe Domain Sequences for d5f35a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f35a1 c.145.1.0 (A:1-298) automated matches {Thermotoga maritima [TaxId: 243274]}
mvdeilklkkekgyiilahnyqipelqdiadfvgdslqlarkamelsekkilflgvdfma
elvkilnpdkkvivpdrsatcpmanrltpeiireyrekfpdapvvlyvnstsecktladv
ictsanavevvkkldssvvifgpdrnlgeyvaektgkkvitipenghcpvhqfnaesida
vrkkypdakvivhpecpkpvrdkadyvgstgqmekiperdpsrifvigteigmihklkkk
fpdrefvplemavcvnmkkntlentlhalqtesfevilpkeviekakkpilrmfelmg

SCOPe Domain Coordinates for d5f35a1:

Click to download the PDB-style file with coordinates for d5f35a1.
(The format of our PDB-style files is described here.)

Timeline for d5f35a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5f35a2