SCOP 1.65: Domain d1fnma2: 1fnm A:6-282

Lineage for d1fnma2 (1fnm A:6-282)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (35 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Elongation factor G (EF-G), N-terminal (G) domain [52633] (1 species)
   has internal nucleotide exchange factor built in as an insertion subdomain

7. Species Thermus thermophilus [TaxId:274] [52634] (5 PDB entries)
   residues 160-252 comprise insertion subdomain

8. Domain d1fnma2: 1fnm A:6-282 [32144]
   Other proteins in same PDB: d1fnma1, d1fnma3, d1fnma4, d1fnma5
   complexed with gdp, mg; mutant

Details for d1fnma2

PDB Entry: 1fnm, 2.8 Å

PDB Description: structure of thermus thermophilus ef-g h573a

SCOP Domain Sequences for d1fnma2:

Sequence, based on SEQRES records:

>d1fnma2 c.37.1.8 (A:6-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus}
eydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqerergiti
taavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqsetvwrqa
ekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidvlrmka
ytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeepteeelvaa
irkgtidlkitpvflgsalknkgvqllldavvdylps

Sequence, based on observed residues (ATOM records):

>d1fnma2 c.37.1.8 (A:6-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus}
eydlkrlrnigiaahidagktttterilyytgriavttcfwkdhriniidtpghvdftie
versmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlwlvirtm
qerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyldqareyh
eklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknkgvqlll
davvdylps

Timeline for d1fnma2:

• d1fnma2 first appeared (with stable ids) in SCOP 1.55
  
• d1fnma2 appears in SCOP 1.63
  
• d1fnma2 appears in SCOP 1.67
  
• d1fnma2 appears in the current release, SCOPe 2.08