Lineage for d1fnma3 (1fnm A:483-599)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325230Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 325231Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (7 families) (S)
  5. 325232Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 325238Protein Elongation factor G (EF-G), domain IV [54213] (1 species)
  7. 325239Species Thermus thermophilus [TaxId:274] [54214] (5 PDB entries)
  8. 325242Domain d1fnma3: 1fnm A:483-599 [37546]
    Other proteins in same PDB: d1fnma1, d1fnma2, d1fnma4, d1fnma5
    complexed with gdp, mg; mutant

Details for d1fnma3

PDB Entry: 1fnm (more details), 2.8 Å

PDB Description: structure of thermus thermophilus ef-g h573a

SCOP Domain Sequences for d1fnma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnma3 d.14.1.1 (A:483-599) Elongation factor G (EF-G), domain IV {Thermus thermophilus}
yretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyipav
qkgieeamqsgpligfpvvdikvtlydgsyaevdssemafkiagsmaikeavqkgdp

SCOP Domain Coordinates for d1fnma3:

Click to download the PDB-style file with coordinates for d1fnma3.
(The format of our PDB-style files is described here.)

Timeline for d1fnma3: