Lineage for d5j8xa2 (5j8x A:263-358)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820866Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. 2820867Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) (S)
  5. 2820897Family b.105.1.0: automated matches [231757] (1 protein)
    not a true family
  6. 2820898Protein automated matches [231758] (5 species)
    not a true protein
  7. 2820913Species Escherichia coli [TaxId:83333] [321360] (1 PDB entry)
  8. 2820914Domain d5j8xa2: 5j8x A:263-358 [321361]
    Other proteins in same PDB: d5j8xa1
    automated match to d1hd8a1
    complexed with ok3

Details for d5j8xa2

PDB Entry: 5j8x (more details), 2.53 Å

PDB Description: crystal structure of e. coli pbp5 with 2c
PDB Compounds: (A:) D-alanyl-D-alanine carboxypeptidase dacA

SCOPe Domain Sequences for d5j8xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j8xa2 b.105.1.0 (A:263-358) automated matches {Escherichia coli [TaxId: 83333]}
fetvnplkvgkefasepvwfgdsdraslgvdkdvyltiprgrmkdlkasyvlnsselhap
lqknqvvgtinfqldgktieqrplvvlqeipegnff

SCOPe Domain Coordinates for d5j8xa2:

Click to download the PDB-style file with coordinates for d5j8xa2.
(The format of our PDB-style files is described here.)

Timeline for d5j8xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5j8xa1